SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000017391 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000017391
Domain Number 1 Region: 443-475,508-591
Classification Level Classification E-value
Superfamily PX domain 2.22e-18
Family PX domain 0.0062
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000017391
Domain Number - Region: 24-125
Classification Level Classification E-value
Superfamily CoA-transferase family III (CaiB/BaiF) 0.0785
Family CoA-transferase family III (CaiB/BaiF) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000017391
Sequence length 909
Comment (Tetraodon nigroviridis)
Sequence
PMTSRFDPEGPGGQGMAEALVRRSLLAGGLLLAWLLLFHLLLNIWLLCVLASLLVALGGW
LTSHAILESNNLVHLERFIRLEQIPSTADDRRRLDQEIRSTVRKIIRDFVTSWFATVSSE
GAFEGEVQAAMIAMAAEMKTRAAQVDRKDLTRRVLDLVGCHLRDFIQAEELLGERRAPAA
DLWTAYGRVATPHPAASDRALEVQYARAAVDLLLQVLVPWPHLESRTGRFVVAELITCNV
LLPLVAKLSEPDWLNGLIVHVCGGPAEAEDPLDRDPPAVRPAELAPPRTSGVPPEAEWTE
SSGGAAVPPDEAEEEPGGGKPHLCDLENGSEADSPSVDCKQTSTDAPAAVGQEEALYAAA
DGSLDLEEACPSPGEADGLPPAGTGDGPHRDGGSPLGTPSRELLLSVEHSSPGEVSEVSP
PQSSSPLPSFSFEPLSSPEGPVLIQNLRITGTITAKEHRGTGSHPYTLYTIKYETALGCE
SAGGLPPGPEEVEAVLSTCEPPSSVAYHTVNRRYSEFLNLQTRLEEKAELRKLIKGVKGP
KKVFPDMPFGNMDSERIEARKGLLEAFLKHLCAMSEIANSEEMQEFLALNTDARIAFVKK
PFIVSRIDKIVVNAIVDTLKTAFPRPDAQSPTEDEAEVDGLKTGSDKKSRSRLRFSGRSV
PFADVSEVRPLRFSCEQRSTVFGRMSLEELERFIAEQEDAASGAEPEPEERPGHGQVLDV
RLGEKRCPEPGSEPGSETALAEAALSILGLLTRKQWSWLCTENVHGTVRLLFGTLLNRWL
DVSVANLTSTRSWVVYLQGVQEAVWPGGQLPAEAPPRRSRRQKDDTRREALRSLMSLLPG
VLVAAVDPDKYRRSWRTFLDSLQNGHINKHLVFCLLDLLLELLVPEVSDQDFQNRLMEKL
SRSPERSPM
Download sequence
Identical sequences H3DA50
99883.ENSTNIP00000017391 ENSTNIP00000017391 ENSTNIP00000017391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]