SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000017578 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000017578
Domain Number 1 Region: 44-126
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000667
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 132-174
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000484
Family Hairy Orange domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000017578
Sequence length 415
Comment (Tetraodon nigroviridis)
Sequence
MERIPSAQPPPLSKHQADLSDVPGMDFPMYVYKPRRGLKRGEENKETYKLPHRLIEKKRR
DRINECIAQLKDLLPEHLKLTTLGHLEKAVVLLTLKHVKALTSLLEQQQQKILALQNGMQ
IGERQPPASQDRSEMFRSGFHMCAKEILQYLVNHEADGDFTPSHAIAHIQKVAAEVLQSP
VRPCSPVSPRPEEAPACHQHPPRKEMPASAPPKPSEGYGRNCVPVIQRAYAPASSEQSGS
DTDTDSGYGGELEKMESGAPQARPDYYGQESQPKRSLSDRQSSAIKQEDEEPRHKRPRAE
SLEDELLSGARGYGSYSMSPNHPPPSHPLCMPFYLIPPSAAAYLPMLEKSWYPGTVPILY
PGMGAMPKERPSPPQLMLSPRGGSPAPAMSQTPMDSPTLLQALKQVPPLNLETKD
Download sequence
Identical sequences H3DAN6
ENSTNIP00000017578 99883.ENSTNIP00000017578 ENSTNIP00000017578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]