SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000017772 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000017772
Domain Number 1 Region: 31-186,216-340
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.3e-63
Family FCH domain 0.0049
Further Details:      
 
Domain Number 2 Region: 503-697
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.22e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000978
Further Details:      
 
Domain Number 3 Region: 747-803
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000494
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000017772
Sequence length 1110
Comment (Tetraodon nigroviridis)
Sequence
MSSHAKVKKDKEIIAEYETQVKEIRNQLVEQFRCLEQQSESRLQLLQDLQEFFRRKAELQ
LEYSRGLEKLAERYSAKIRTSREHQHLKKDQNLMSTVNCWYLVLEQTRRESKDHATLSDI
YNNNVIVRLAHVGEDVIRLFKKSKDIGVQMHEELVKVTNELYTVMKTYHMYHTESLSAEN
KLKEAERQEEKHIGKANDISSALLRYGHDERPQRRSSVKKMEKMKEKRQAKYYENKLKCT
KARNDYLLNLAATNALVAKYYIHDVSDMIDCCDLGYHASLARTLRTYLSAEYSLETSRHE
GLDLLEGAVDAMDIRGDKHKFMDTHNQIFCPPACFDYQPHMGDEVCQLSAQQPVQTELLM
RYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSQSTESVKSASSD
SYMSKANISKRRANQQETEGFYFTKYKEYLNGSNLIVKLEAKHELLKQTLGEGERAEYGT
TRPPTLPPKPQRMRKSRPRSIFNRRLFNGNMEAFIQDSGQPIPVVVESCVRYINLYGLQQ
QGIFRVPGSQVEVNDIKNAFERGEDPLVDDQSDHDINSVAGVLKLYFRGLENPLFPKERF
LDLISTTKLDSGVERAHQLHQIIVTLQRPVIVVMRYLFAFLNHLSQYSDENMMDPYNLAI
CFGPTLMPIPDEQDPVSCQAHVNEVIKSVIIHHELIFPTQRELEGPVYEKCMAGGEEYCE
SPHSEPGTLDEVDNGPNTSDEELEQIEAIAKFDYVGRSPRELSFKKGASLLLYLRASEDW
WEGRHNGVDGLIPHQYIVVQDMDDAFTEGVPRTSNAASGPQHDERAAHRTDHQSPCEHTP
EHRYGAAVGRRVRVRSDGAAVPRHRNTTDNHSPSRAPDQPPRVLPRPGSPHKVAVNRGPA
DSPEKRRLTTFGSAGCISHPERKAFVESLAQRSSPIAARHPNLGDHKAFETEALAEDIEK
TMNTALHELRELERQNVAKHAPDVVLDTLEPHKHPSGAQDPTGSPLHTMVIRDPDAAQRR
SSSSSSSETMTTFKPALSARRPNAPLRPPPVRPVRPAPVIGQGQGPQRSSSSSSSGLGSP
SITPTDRVFPKPPSPSPSNSSSSSDKQGNM
Download sequence
Identical sequences H3DB80
ENSTNIP00000017772 ENSTNIP00000004834 99883.ENSTNIP00000017772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]