SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000017875 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000017875
Domain Number 1 Region: 107-209
Classification Level Classification E-value
Superfamily TAFH domain-like 4.58e-40
Family TAFH domain-like 0.00000306
Further Details:      
 
Domain Number 2 Region: 501-542
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000000331
Family MYND zinc finger 0.00036
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000017875
Domain Number - Region: 435-503
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.0235
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000017875
Sequence length 597
Comment (Tetraodon nigroviridis)
Sequence
VLGVVGGYELNSREKSPAMPGSPVDAKTHSRSAPSSLASSTMPPLPSVNPSGPRPASFST
TALTNGNHHSPPTLNAVPSPPQRYSNGPSSSSSSSLANQQLPATCGARQLSKLKRFLTTL
QQFGNDISPEIGDNVRSLVLALVNSTVTIEEFHSRLQEATNFPLRPFVIPFLKANLPLLQ
RELLHCARAAKQTPAQYLSQHEHILLSTTMASSPDSSELLMEPPEVGTKRHSPARGKENG
FHERPPVALEPAAKRICTISPAPRHSPAHPLPLSTQLHPTPPPLQHYALDDIAAPHILHR
EHSQRMLEIRELKDRPRLPGTNGGYREEPVDHRLTDREWADEWRHLDHVLNCIVDMVEKT
RRSVSVLRRCQESDREELNYWRRRSSEQEDPRKGGSGSGPFSKTHSPHSAESGIKYSQRD
FAQRPASAYVTDEIWRKAEEAVNEVKRQAMDEVQKAVAEAEQKAFEMIAAERAKMEKTLA
EAKRKAQEDAIMIINEQEDSSECCWNCGRKASETCSGCNAARYCGSFCQHKDWERHHLIC
SPGLQAQPKPVSAITAVSPVGVKATDSVPSVSSPGGEKTAVASRSSTPSTPASAPET
Download sequence
Identical sequences H3DBI3
ENSTNIP00000017875 ENSTNIP00000017875 99883.ENSTNIP00000017875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]