SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000017921 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000017921
Domain Number 1 Region: 297-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000963
Family Laminin-type module 0.043
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000017921
Domain Number - Region: 469-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000239
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 97-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0893
Family APC10-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000017921
Sequence length 537
Comment (Tetraodon nigroviridis)
Sequence
MFWPLLFTLQASCSSVARAMQHYPAAWGHYDVCKSQIYTEEGLAWDYMACQPEATDMTKY
LRVTLDPPNITCGDPPETYCALENPYMCNNECDAATEELAHPPELMFDFEGRNPTTFWQS
TSWKKYPKPLHVNITLSWNKTIELTDDIILTFESGRPEQMVLEKLDYGRTWTPYQFYATD
CLDAFTMEPKTAKELTQRTLLDIICTEDYSRGYVWKNDKTVRFEIKDRFALFAGPRLHNM
ASLYGQLDTTKNLRDFFTITDLRIRLLKPATGATMVDENNLSRYFYAISDIKVQGRCKCN
LHANSCVFDKGKLGCECEHNTTGADCSRCKKHYHGRAWSVGSYLPIPKGTANICIPTSST
VRRTEIIGYRENKCLYVSFHHASICMLMPEAVRGEQKVFAALGIANSSDSQPYLHETHNN
LCPSVHTAINLSSVCHFNPGRKSQRCEEHMPCTSGHCWCLTRVCDNAMLRCQNGGTCHHH
QRCHCPPSFTGILCERAHCQGTEECDDQLSGRASFNQPTAGRWLIGHVVAMRLLIVF
Download sequence
Identical sequences H3DBM8
ENSTNIP00000017921 99883.ENSTNIP00000017921 ENSTNIP00000017921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]