SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000018344 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000018344
Domain Number 1 Region: 313-590
Classification Level Classification E-value
Superfamily Kelch motif 8.11e-72
Family Kelch motif 0.0000393
Further Details:      
 
Domain Number 2 Region: 46-161
Classification Level Classification E-value
Superfamily POZ domain 2.94e-32
Family BTB/POZ domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000018344
Sequence length 599
Comment (Tetraodon nigroviridis)
Sequence
MVLILGRRLNREESGIRDSPAIKRKVFDVDSKTLASQEVLDFCSGSSHSDGILQVFNEFR
DCRLFTDVVISVQGREFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMDSF
LTYVYTGRAKITTENVQFLFETSSLFQINTLRDACAKFLEDQLDPCNCLGIQRFADVHSL
KQLAGRCRSYALANFSEVAQHEEFLDLHREELEDYIGSDELSIRKEEVVFEAVMRWVYSD
VEQRRPMMKALLHHVRLPLLHPNYFVQTVEGDQLIQNAPECYQLLHEARRYHILGNEMMS
PRTRPRRSTGFSEVIVVVGGCERVGGFNLPYTECYDPVTGEWKALAKLPEFTKSEYAVCA
LRNDILVSGGRINSRDVWMYNSQLNLWIRVASLNKGRWRHKMCVLLGKVYAVGGYDGQSR
LSSAECYDSFSNRWTEVAPMKLAVSSPAVASCAGKLFVIGGGPDDDTCSDKVQCYDPEAD
TWLLRANIPIAKRCITAVSLNNLIYVCGGLTKSVYCYDPSQDYWIHVVHTFTKLESCGMS
VCNGKIFILGGRGESGEATDTILCYDPATGIVMSIAAMPRPISYHGCVTIHRYTDKYHR
Download sequence
Identical sequences H3DCV1
ENSTNIP00000018344 99883.ENSTNIP00000018344 ENSTNIP00000018344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]