SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000018479 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000018479
Domain Number 1 Region: 957-1122
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.81e-31
Family SPRY domain 0.0023
Further Details:      
 
Domain Number 2 Region: 767-953
Classification Level Classification E-value
Superfamily Fibronectin type III 5.92e-23
Family Fibronectin type III 0.0047
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000018479
Domain Number - Region: 574-622
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00128
Family B-box zinc-binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000018479
Sequence length 1133
Comment (Tetraodon nigroviridis)
Sequence
LEGIRTKDQQLFSLISEGYEILNIRVPTKLPTVDEEESTELQDNLSYLDQTPKIKSRNQE
WTQQGSLVLQDEETPAHGEYLRERRQPTESSQPAVESELRPQRDGASDIDYFEKFTLVDA
VGPGEHAREEQETGRPAAKGTSERSEPVQETPKDGLPASEDSFVIVSDADIVGEHLDEVF
YGGGAPAERGYKAECGAGTRSRRESQRSAKESGSVLFETEETTLTPIFISPGPPKIIDPI
LLEEPAAMSFMYSDLYEDAVGERRKSDEEHSESESVASEKTSRRRLSDAEEADGYLEKFI
LKDETPTVELPPESAEDRREGGMMWAQRVDGEGRGGEMGNQSCQSQREEEIMDQGAATVT
DESVGVVVAAGGQDTPTGSETETSQWEEKGAVASSSVEATAEWDAAASGEGTDKCLEEEE
LHMELQEPGRAKEEEFTQDNENSVDETAAEDFVLLVPKAPAEDAITHQEEVGKHEGVVSS
LRSFIPQEESSGLEEDMSLEAESPDVNAEELDYEVICEQEAEELRGAEEPEPEPEPQQEL
THLSPEEEQIEDDYEVFDAEEERQARLAAELQGLDWFCFTCGDLLSKDERASEEHRNHEV
ADVDAAYEQIKERLSGWISELQEGSENLEDLVSDLEVAYNSVEEQCVEVEAAMRAQNEEM
MALVMDQYNDMSVGMEEEKKAKLEQIYDQIVSVQDSIDSARTTLETTAREAETEARMPED
INARLKAAWESAASLELGPQVLMVFEDYAKGHTSSSHVERCKGIPVPQRPRLQPQEPGSA
TSTSVTVYWRVGPGDVIDCFQVYCMEEPRGVVSEEYRVTVKESSCVLEELEPDKTYKVWV
MAVNYTGCSLPSDQLAFRTAPSVPVIDAEQCTVLWDSATLRWSPSHQVPQQRFTLEYCRQ
YEPEGEGLRSISGIGGCERKVPLQPNENYLFYIKAANEAGTSEQSEAALVSTRGTRFQLL
GHTAHPALELSADRTTLHYCHQAPEGSAPTDAECPSILGELLLPPGRYYWETVVTRGTAY
RLGVVTGAASRRSPLGENSLSWCLQCVPAVSGYHLLHINIQSSLFVTETPERVGTLLDYQ
LGRLSFYNAHSGQLLGAFCQRFAQPCHPALALEMPGSLEVSMVLEMPDFLKNS
Download sequence
Identical sequences H3DD86
ENSTNIP00000018479 99883.ENSTNIP00000018479 ENSTNIP00000018479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]