SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000018491 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000018491
Domain Number 1 Region: 3-287
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.18e-56
Family Ankyrin repeat 0.0000902
Further Details:      
 
Domain Number 2 Region: 318-414
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000299
Family DEATH domain, DD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000018491
Sequence length 425
Comment (Tetraodon nigroviridis)
Sequence
MAPIHLAAWFGSLDILKLLVQAGAEQKVENQEGQNIMHCAAINNHTDIIEYIINDLQMKE
LDKEDNSGNRAFALAADNGCVNMLEVLREQYNMDTMKPNQTGDTPLHLAARNGHLDAIDM
LLLHFETRDEVNLDGETALYLAVNNGHDACALALLEAGCEPNIFMGKSSVLHPVSEKGDT
SFLQLLLGHKADTNARNQDQEAPLHLAVKNNHIPVIHCLLTAGCDINATDKRSQTALHIA
AELAKIDVVEMLLKAEFDLTIEDKQGKTALGVAARADEAIIADMIIKAERYYAWRKANPE
VNETVHSQYPLTFKPDHRLETKQFRSVVWRLAYELLKPADWKRLAEHWAFTKEQILAIEE
QWTGQHSYKEHGNRMLLIWLHGAELAGMSPAKELYQALVSTGNSKAADRIRMEEEDTRSK
NCNIS
Download sequence
Identical sequences H3DD98
ENSTNIP00000018491 99883.ENSTNIP00000018491 ENSTNIP00000018491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]