SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000019026 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000019026
Domain Number 1 Region: 99-165
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000141
Family Ovomucoid domain III-like 0.00029
Further Details:      
 
Domain Number 2 Region: 263-317
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000043
Family Ovomucoid domain III-like 0.0073
Further Details:      
 
Domain Number 3 Region: 192-240
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000388
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 4 Region: 27-70
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000942
Family TB module/8-cys domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000019026
Sequence length 320
Comment (Tetraodon nigroviridis)
Sequence
MFGMLKHHLHPGVLLFFVWLCHLMEHQKVQAGNCWLQQGKNGRCQVLYMPGMSREECCRS
GRLGTSWTEEDVPNSTLFRWMIFNGGPNCIPCKETCDNVDCGPGKRCKMNRRSKPRCVCA
PDCSNITWKGPVCGTDGKTYKDECALLKAKCKGHPDLDVQYQGKCKKTCRDVLCPGSSTC
VVDQTNNAYCVTCNRICPEVTSPEQHLCGNDGIVYASACHLRRATCLLGRSIGVAYEGKC
IKAKSCEDIQCSAGKKCLWDARMSRGRCSLCEETCPESRTDEAVCASDNTTYPSECAMKQ
AACSLGALLEVKHAGSCNCK
Download sequence
Identical sequences H3DET3
ENSTNIP00000019026 ENSTNIP00000019026 99883.ENSTNIP00000019026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]