SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000019030 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000019030
Domain Number 1 Region: 212-342
Classification Level Classification E-value
Superfamily PX domain 2.62e-30
Family PX domain 0.0014
Further Details:      
 
Domain Number 2 Region: 3-64
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-17
Family SH3-domain 0.0011
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000019030
Domain Number - Region: 371-574
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0188
Family BAR domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000019030
Sequence length 577
Comment (Tetraodon nigroviridis)
Sequence
MALQARALYDFNSENPGEVSVKENEILTLHSEEDIDGWLEGSNSKGERGLFPASYVEILR
GNATSALNNNSTSTSGDTYRDSRYANVPPGGFDASYAPQTKVDNFSKSSSSSTFTQQQQQ
QASDDDWDDDWDDSSTVADEPGSAGRRYQDFDGNGLSTYRVSTSSMSRGNAQHAKSSATV
SRNLNRFSTFVKSGGEAFVLGEASGFVKDGDKLCVVMGQYGPEWQENPYPFTCTIDDPTK
QTKFKGMKSYISYKLTPTHTQNQVNRRYKHFDWLYARLVEKFPVISVPHLPEKQATGRFE
EDFISKRRKGLIWWMNHMTSHPVLARCDVFQHFLTCSSTDEKAWKQGKRKAEKDEMVGAN
FFLTISTPPAPLDFQEVESKVDGFKAFTKRMDDSTLQLNATASEFARKQMSGFKKEYQKM
GLSFKVLGQAFEMDQQPYSARLNQALSFTAEAYDAIGDYFAEQPRKDLDPIMDLLGLYQG
HLANFPDIIHVQKGALTKVKESQKHVEEGKMDLAQAEGINDRCNIISCATLAEIQHFHQI
RVRDFKAQMQHYLQQQISFFQRVTGKLEEALQKYDDV
Download sequence
Identical sequences Q4RSN7
ENSTNIP00000019030 99883.ENSTNIP00000019030 ENSTNIP00000019030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]