SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000019489 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000019489
Domain Number 1 Region: 53-267
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.98e-63
Family Ankyrin repeat 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000019489
Sequence length 294
Comment (Tetraodon nigroviridis)
Sequence
ERLDSSYGSSSITIESLSENVGGCTISSPGEEPGQSPELSEQEENLLTTITEDGDTILHL
AIIHEEELFAQQLIQLFPKNVLDIQNNLYQSPLHLATYLNLTPVVRELMEKGASLELQDR
DGNTALHVACQQGQTEMAGEMTRRVSPSQLAPILETQNWKGLACLHLAALNRQHQIISDL
ARKGANLNIQEGTSGKAPLHFAVELRDITTVKLLLSRGANVDPAMFNGCTPLHLAVGRRD
AAIANILCQSGADMMLRNVEDETALDLADGNDDILAVFPFDDIQISDKMYLCTI
Download sequence
Identical sequences H3DG45
ENSTNIP00000019489 ENSTNIP00000019489 99883.ENSTNIP00000019489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]