SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000019546 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000019546
Domain Number 1 Region: 32-175,207-269
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.07e-50
Family BAR domain 0.00000988
Further Details:      
 
Domain Number 2 Region: 508-583
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-16
Family SH3-domain 0.0000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000019546
Sequence length 584
Comment (Tetraodon nigroviridis)
Sequence
MAELNLGKGLTAGKVASNVQKKLTRAQEKVLQKLGKADETKDAAFEEGVINFNKQYAEGS
KLQRDLRAYLEAVKAMHESSKNVQACLADMYEPEWYGKNEVDSIVEDCDVLWTDYHQKLV
DHALISMDTYLGQFPDIKARIAKRDRKLVDYDSARHNYAITHKTKKKDGGIKITKPSSLL
ERATPGWAQGLLSAHNVAQSSLSRSQAEEELERAQKVFEEINIDLQEELPSLWNSRVGFY
VSTFQSLAGFEEKFHKEIGRLDQDLYDILEKLEGTDTSGLKSNNWSNVVLSGNKCSTDLK
PTPCLQKDSVKEASNHTLRPGGPPPIPKSPSRLKPAVPPPPKVTPSKDMKAENIVNLFDA
AAAPDISVTSPTEFDRPAVSSLLDVDLDSFTSTVTETEFQNQGWHFVTELGETCSSTVAA
RSGATPPLLQSSFSLSPSDHSDADDTEPVAEAQEGWGDDGSQPVTEEETPAAEATEEESV
QAATAMDGEEGQPPAAAAQPTEEASEAIEMPPGFLFKVQVMHDYAPNDTDELEMKAGDVV
LVIPFENPDEQDDGWLMGMKQHDWQQNKENAAKGVFPENFTQRL
Download sequence
Identical sequences H3DGA2
99883.ENSTNIP00000019546 ENSTNIP00000019546 ENSTNIP00000019546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]