SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000019707 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000019707
Domain Number 1 Region: 448-636
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.49e-25
Family Pectin methylesterase 0.076
Further Details:      
 
Domain Number 2 Region: 589-751
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.92e-24
Family Pectate lyase-like 0.058
Further Details:      
 
Domain Number 3 Region: 79-162
Classification Level Classification E-value
Superfamily F-box domain 3.01e-21
Family F-box domain 0.0021
Further Details:      
 
Domain Number 4 Region: 190-411
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.14e-21
Family Pectin methylesterase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000019707
Sequence length 852
Comment (Tetraodon nigroviridis)
Sequence
DVPADMVAEESGPGAQNSPYQLRRKSLPKRTVCPTKTNMEGGFNFNPQKIFGHRPKRPRV
TGKCQDLPAAPAEQYLQEKLPDEVVLKIFSYLLEQDLCRAACVCKRFSELANDPILWKRL
YMEVFEYTRPMMHPEAGKFYQINPEEYEQPNPWKESFQQLYKGAHVKPGFAEHFYSNPVR
YKGRDNMFYYDTIEDALGGGQEPHFDGLIFVHSGIYTDEWIYIESPITMIGAVAPGKVAE
KVIIENTRDSTFVFMEGSEDAYVGFMTIRFNPDDKSAQHHNAHHCLEITVNCSPIIDHCI
IRSTCTVGSAVCVSGQGACPTIKNCNISDCENVGLYITDHAQGIYEDNEISNNALAGIWV
KNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIH
HGQTGGIYVHEKGRGQFIENKIFANNFAGVWITSNSDPTIRGNAIFNGNQGGVYIFGDGR
GLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLA
GVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQISIDRTGSNPK
IRRNKIWGGQNGGILVYNSGLGFIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGI
CIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFDGFAAGIEITNHATATLEGNQ
IFNNRFGGLFLASGVNVTMKDNRIMNNQDAIEKAVSRGQCLYKISSYTSYPMHDFYRCHT
CNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDS
APPIESNTLQHN
Download sequence
Identical sequences H3DGR3
ENSTNIP00000019707 ENSTNIP00000019707 99883.ENSTNIP00000019707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]