SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000019856 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000019856
Domain Number 1 Region: 309-478
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.17e-28
Family Ankyrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000019856
Sequence length 852
Comment (Tetraodon nigroviridis)
Sequence
MEAPEYLDLDEIDFSDDSVYSVTSLKSIPELSRRSDGQAEERQAPAINWSRGIPAHSSGV
IKPTGLAEVHSKFRPVKRVSPLKHQPETPDSESDGKLQNQGQGEPGEGNKDDPCLDKPMP
ASTSTDGSEGKANNPQALFGELEHYDLDMDEILDVPYIKSSQQMSTLPRVPHDKRSPVGK
IFVSAVRLKVAPRCLSHASTSFMTKYCVLSPLKWSDLRKSKSMDPDFHHPHHSTVGYQSD
FMSSGHLSCSSSLSSFSDAGMATNHPLSGLKPVIGAGGEVDEETKKNQNIINIVREGQIS
LLPHLAADNLELIRDEDANNLLHISASQGHADCLQHLTSLMGEDGLNERNNQQLTPAGLG
VKNGHLECVRWMVSETEAIAELSCTREYPSLIHYAARYGQEKVLLWLLQFMQEQAISLDE
VDQNGNTAVHVAAQYGHLTCIQTLVEYGSNVTIQNQQGERPSQSAERQGHTTCARYLVVV
ETCMSLASQVVKLTKQLNEQATDRMALQKQLQRLMDPNKPEGTPSRSPSSHQPSVEAWPE
MMLTAEGTPGDGQWLVRQGGVGSDSVLRQLLGKDMTDTLCPRERLPQVGGLSREGPGVTG
ARRTGLVERRELKLARLKQIMQRSLSESDSDGYPADEGKNPAGSISGRADRPSHLPIAEE
EPVSNHLNLMMRKHLPSASASTAEKKLAFSLSGSKSVDSIGYNPSPTSSDPEAADGKTPD
AAADFHDGANGQKVATSPKSALKSPSSRRKTSQNSKLRVTFDEQVQKNSSQETEQTKETK
GHHGKERTAAGGSEGKRPFGAFRSIMETLSGNANHNNNNSGGQSATCQISPGKKSEGKGG
PGTGARGKSKTS
Download sequence
Identical sequences H3DH62
ENSTNIP00000019856 ENSTNIP00000019856 99883.ENSTNIP00000019856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]