SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000019951 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000019951
Domain Number 1 Region: 164-438
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.6e-81
Family Eukaryotic proteases 0.0000414
Further Details:      
 
Domain Number 2 Region: 40-102
Classification Level Classification E-value
Superfamily GLA-domain 2.94e-24
Family GLA-domain 0.00044
Further Details:      
 
Domain Number 3 Region: 127-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family EGF-type module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000019951
Sequence length 440
Comment (Tetraodon nigroviridis)
Sequence
MRLMKQTVKVWLYSVASGPAPLFLPAQAAGSVLQRPKRANTGFFEEVLEGNLERECLEEK
CDLEEVREVFEDDEKTMAFWLEYTDGNQCLSNPCLNQGSCKGLLGSYTCSCRPGFAGTHC
EIIIAKRCDVNNGDCMHFCEPLGTFGAKCSCVTGYRLADDGLSCQPETEFPCGRTVLTQE
TSDPTTAPGDEEPKPFKRIVGGKLVIPGEIPWQVALMRRSTGELFCGGSILSERWVITAV
HCLLKKKDSFYVRVECAGEHTLSIQEGTERNYDVLELHVHPFYNATLSLYNHDIALVHLK
SPITFSKTVRSICMGPRAFTDFLIKSSSSATVSGWGRTRFLGLTADSLQKVEVPFIDQTE
CKRSSSSRITSYMFCAGYYNKAKDACQGDSGGPHANSIHDTWFLTGIVSWGEECAKEGKY
GVYTRVSLYYPWINYVMGSA
Download sequence
Identical sequences H3DHF7
99883.ENSTNIP00000019951 ENSTNIP00000019951 ENSTNIP00000019951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]