SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000020298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000020298
Domain Number 1 Region: 106-412
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.66e-118
Family Glutaminase 0.00000415
Further Details:      
 
Domain Number 2 Region: 438-525
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.95e-17
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000020298
Sequence length 547
Comment (Tetraodon nigroviridis)
Sequence
HGHKPAHENLKRRKAGILPSLEDLLFYTIAEGQEKIPAHKFTTALKSTGLRTGDPRLKEC
MEMLKVTLKTTSDGALDRHLFKKCVQSNIVLLTQAFRKKFVIPDFQSFCAHIDDLYENAK
NLSGGQVADYIPQLARFSPELWGVALCTVDGQRHTVGDTKVPFCLQSCVKPLKYAIAVHD
HGTEYVHRFIGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVCTSLIKQGASNAEKFDYVM
NFMNKLAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMTSILDFYFQLCS
IEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLP
AKSGVAGGILLVVPNVMGIMCWSPPLDKLGNSVRGIQFCTDLVSLFNFHNYDNLRHFAKK
LDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSSMDMEQRDYDSRTALHVAAAEGHA
EVVRFLLEACKVNPVPKDRWGNTPMDEAVHFGHHDVVTILQDYHNKYSPQDPATDKQNAE
KNLDGML
Download sequence
Identical sequences H3DIF4
99883.ENSTNIP00000020298 ENSTNIP00000020298 ENSTNIP00000020298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]