SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000020623 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000020623
Domain Number 1 Region: 87-225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-35
Family Galectin (animal S-lectin) 0.00024
Further Details:      
 
Domain Number 2 Region: 2-56
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000749
Family Galectin (animal S-lectin) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000020623
Sequence length 226
Comment (Tetraodon nigroviridis)
Sequence
LPYKHGAPFETIILAQGDAFKVAVNGAHLLEYKHKIPLNRVDTLSVSGGVSVHAIAYIPN
SVATSLLCSFLKYTTVQYSHVVAPPIRWNALPYKGSILKGLIPGQHITIKGQVSTYPHSL
PSASQSTCADGTENVALHLNPRIKSGVFIRNSYLGGSWGQEERELPFFPFSSGGYFEILL
LCQPHQFKLAVNGCHLFEFRHRVQDLSSIDQLEIMGDLELADVKLW
Download sequence
Identical sequences H3DJC7
ENSTNIP00000020623 ENSTNIP00000020623 99883.ENSTNIP00000020623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]