SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000020702 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000020702
Domain Number 1 Region: 220-282
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.09e-16
Family B-box zinc-binding domain 0.0015
Further Details:      
 
Domain Number 2 Region: 583-615,649-746
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000538
Family SPRY domain 0.022
Further Details:      
 
Domain Number 3 Region: 426-532
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000305
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 4 Region: 25-64
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000172
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000020702
Domain Number - Region: 169-203
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00889
Family TFIIH p44 subunit cysteine-rich domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000020702
Sequence length 767
Comment (Tetraodon nigroviridis)
Sequence
MAEMDFKTASSTMEALARISSNMKSLEFELHCPVCKDITKQPIVLPCQHSVCLMCASEVL
VASGYPPPELPAEPNSPASTPNTRSPRQARRPTPKAEQRPIERVLRAGHGTYPGRRRKEG
PPLVMMFPCVPCGRDVELGEKGLTDCLRNLTLERIVERYRHTVSLGSVAVMCQFCKPPQT
LEATKGCADCRANFCNECFKLYHPWGTPRAQHEHIQPTLNFRPKVLTCPEHDQEKLQFYC
RSCQRLLCPLCKLRRVHSGHKILPVAHAYQALKEKIAKEMNYILSNQDTVLAQITQLESS
ITQTEVNSVSAREQLAQSIRDLTAALAERHASLTQALEVTRQTRPAWLLQVAELRRSLME
HAGLVAFTQELLKETDQPCFVQAARQIHNRKVCVAETLQNFSLDADPSFRHFQLDVSREL
KLLTELNFIQAPQAPVIDTQRSLAYDQLFLSWRLPPDSAPAWSFSVEYRRRGVGPGRGGQ
GRDQRLDEVSASSAVIDRLEMDSVYVLRVRGCNKAGYGEYSEEVYLHTPPAPVLNFYLDS
RWGLHADRLVVSKEQRGARSIPGLSLLQAADHALTSCHLTSDLLVGDVAITQGRHYWACS
VEPGSYLVKVGVGLESKLQEWFHLPQDMASPRYDPDSGHDSGAEDNLDSAPPFCFLTMGM
GKIYLPQHTYNHHGNGTRDNGPSSPAGLTYPLPPRLGVCLDFEKARVTFYDAHSLRPLWE
GHVDCSGPVCPAFCFIGGGALQLQELVANRNADQTPVRRVTIQTRVS
Download sequence
Identical sequences H3DJK6
99883.ENSTNIP00000020702 ENSTNIP00000020702 ENSTNIP00000020702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]