SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000020937 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000020937
Domain Number 1 Region: 48-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000432
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000000837
Family Hairy Orange domain 0.00008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000020937
Sequence length 277
Comment (Tetraodon nigroviridis)
Sequence
MKRNHDFSSSDSELEETIEVEKESADENGNMSSPLGSMSPSTSTQVQARKRRRGIIEKRR
RDRINNCLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHAAGGKGYFDAHALAMD
YRGLGFRECLAETARYLSIIEGLDGADPLRLRLVSHLNSYASQREAHSGLSHLAWGAFAS
PAAHLAHPLLLQHQQHQPLAPSSSVAEAHAASAGRRSGSATPHSDQGPLRGPPPTAVVSS
SASKLSPPLLSPLAAFPFQSAGVGKPYRPWGLEIGAF
Download sequence
Identical sequences H3DK91
99883.ENSTNIP00000020937 ENSTNIP00000020937 ENSTNIP00000020937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]