SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000021199 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000021199
Domain Number 1 Region: 111-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.89e-26
Family BAR domain 0.0059
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-21
Family DBL homology domain (DH-domain) 0.0013
Further Details:      
 
Domain Number 3 Region: 442-501
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-17
Family SH3-domain 0.00034
Further Details:      
 
Domain Number 4 Region: 346-428
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000254
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000021199
Sequence length 506
Comment (Tetraodon nigroviridis)
Sequence
RKIYEQEGKPNLLDMGSLLIKPVQRVMKYPLLLGELWQATPEDHPDYRPLQEALTAIKII
NVNINEFRRRKDIVMKYKRVEDESTLRGKESNHRKEEKNTPNKKNLIFFFEPQVRDEIFD
REEKLFRSEKAVRLLVKNVHWYLQHAQELVSVAVQNVLDMGDIVKEPTKNGMAHSSHSNG
NDPYKHFKDSMECSVLVPLTSLQGMFTGPQKLIQKRYDKLLDYCSRLEPTTDETSGPARR
DYEALNAMLVEELQRFNMAAFTILNNSVVNLVTLLLRLIDMILAGSPSIHQLPAPLSNSA
EVQNSIMEELNNLTFVKDNAQKLMERKVSFERQRDKKMTMPEVQHQTEEQRARLLAEHPV
SRLYQLKRKCNGCQEQDLSLLEGELVALLEDTDPSGSSSRWLVHTGGSQGYVYSTFLKPY
NPLRDSQRWGQTCRDQQNFRSFSENQFYAVYAFQARSDQELTLQEYQHVRILQFSDLGGN
KDWWLAECNGQRGYVPANYLGKMSYA
Download sequence
Identical sequences H3DL01
99883.ENSTNIP00000021199 ENSTNIP00000021199 ENSTNIP00000003168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]