SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000021252 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000021252
Domain Number 1 Region: 26-102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000129
Family Growth factor receptor domain 0.0042
Further Details:      
 
Domain Number 2 Region: 98-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000575
Family Fibronectin type I module 0.06
Further Details:      
 
Domain Number 3 Region: 223-267
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000288
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000021252
Sequence length 376
Comment (Tetraodon nigroviridis)
Sequence
ITGDLFKMLMVTIAVLFIGSLNVCPAMCECPLEMPHCAPGVSVVLDGCGCCKVCARQLNE
DCSLTEPCDHTKGLECNFGASFAGATTRGICRAKSEGRPCEYSSRIYQNGESFQPNCKHQ
CTCIDGAVGCVPLCPQELSLPNLGCANPRLVKVAGQCCEEWVCDDGKQTDVLERIFGKDV
LTDELERDLTNKNELISVVNGGGLKSLAAFRPQPEVQLFDNHKCIVQTTPWSQCSKSCGT
GISTRVTNHNSECKLVKETRLCEVRPCTQSPYSSLKKGKKCSRTKKSSQPVKFTYAGCSS
LKKYRPKYCGACVDGRCCSPHVTRTIRVKFRCEDGETFNKNIMVIESCKCTYNCPHVNEA
SYPFYRLSNDIHKFRD
Download sequence
Identical sequences H3DL54
ENSTNIP00000021252 99883.ENSTNIP00000021252 ENSTNIP00000021252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]