SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000021365 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  99883.ENSTNIP00000021365
Domain Number - Region: 261-300
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00207
Family Ankyrin repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000021365
Sequence length 303
Comment (Tetraodon nigroviridis)
Sequence
TGSGAVWTMALTQESVLFRLINDGGKVKKSEIVSDFRGLVDCLDPAERQRNRELFKTFVN
SVATVREIDGVRYVVLRKMYQHLLDGEPGPGGSRRTGEQRSPPERRDTAGGCDEAAGSRT
AVSGADEESGGGSPPELRAALRRGRFSGFRPRKSLNFEVQERQTCGDQQPASNQSKPYAL
PLRIPAPRLEVSKLDPDPPQGSTGDSPLSKKRLPLAERGCSSPRLRRGPKSAEEPGEARA
STSTVPLEDVEHQWLVKCAAGHWGQVYGLLLRHSHLAQKRDFVSGFTALHWAAKCGNTSM
LVK
Download sequence
Identical sequences H3DLG7
ENSTNIP00000021365 99883.ENSTNIP00000021365 ENSTNIP00000021365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]