SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000021411 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000021411
Domain Number 1 Region: 130-378
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 1.06e-81
Family Oxidoreductase molybdopterin-binding domain 0.0000000127
Further Details:      
 
Domain Number 2 Region: 380-507
Classification Level Classification E-value
Superfamily E set domains 1.75e-37
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.00000482
Further Details:      
 
Domain Number 3 Region: 39-120
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.1e-20
Family Cytochrome b5 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000021411
Sequence length 510
Comment (Tetraodon nigroviridis)
Sequence
RWTHVLAGLVAGTGAVLAYSLHHHKAQQTETAIEKRSALPVFTQEEVTSHRSLEDGVWVT
YRGGVYDITEFVAVHPGGDKILLAAGGALEPFWSLYAVHNQEHVLEILSEYKVGELSAED
LKKQRSVQTADPYSSDPVRHPGLRVNSLKPFNAEPPSEILSDSYITPSAIFFKRNHLPVP
RVDPGSYRLQVEGLPGGALALTLEDLKTKFPKHTVTATLQCAGNRRSEMNEVKQVKGLNW
GIAAISNATWGGAKLRDVLLAAGYRPEVATWARHVQFEGLDRDASGTYGASIPINKAVSE
DGDVLLAYEMNGEDLPADHGYPLRVVVPGTVGARNVKWVGRITVSAEESGSHWQQNDYKG
FSPGTDWDTVDYKSAPAIQELPVQSAITSPADGAAVEGSSQEVTVRGYAWSGGGREVVRV
DVSLDGGKTWQVARLEGGQDQAPPPPGRAWAWKLWELQAPLPPGAQELEIVCKAVDSSYN
VQPDSVLPIWNLRGVLSNAWHRVRVKVRED
Download sequence
Identical sequences H3DLL3
ENSTNIP00000021411 99883.ENSTNIP00000021411 ENSTNIP00000021411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]