SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000021660 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000021660
Domain Number 1 Region: 28-140
Classification Level Classification E-value
Superfamily PH domain-like 2.81e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000932
Further Details:      
 
Domain Number 2 Region: 212-311
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.44e-30
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000699
Further Details:      
 
Domain Number 3 Region: 326-435
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 4.58e-20
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000021660
Sequence length 448
Comment (Tetraodon nigroviridis)
Sequence
PATMSVPPPQRRQTNVGSLLLTPHENECLFNCLGRKCITMSSAVVQVFMADRHSSWNKRC
CGVACLVKDNPQRSYFIRVFDIKESKMAFEQELYNNFSIYLSRPFFMTFAGDTCQVGLNF
ANEEETKRFRGHLMDLLQRRQRKSEKKREPPNGPSLPMATVDIKNPEISNIPRYNNSQMN
NIVHSSFPKREKKNKGGGKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNL
FDVCGINEAQLKDKETSKVIYDFIEKNGGVEAVKNEFRRQGEAPGPWPRAVALGRGPWAV
APGRGPRPPLDALSSLVSSSPGPAPAPPPPPPSRANGGDGGPPGKSALLSQIREGTQLKK
VEQKERPVSSSGRDALLDQIRQGIQLKTVSPPPRDETTDSAPPAAAPSSGIVGALMEVMQ
KRKAIHSSDEDDDDDEEEDFEDEDEWDD
Download sequence
Identical sequences H3DMB2
99883.ENSTNIP00000021660 ENSTNIP00000021660 ENSTNIP00000021660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]