SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000021869 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000021869
Domain Number 1 Region: 181-383
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.97e-30
Family Pentraxin (pentaxin) 0.00056
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000021869
Domain Number - Region: 78-167
Classification Level Classification E-value
Superfamily Tropomyosin 0.00275
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000021869
Sequence length 397
Comment (Tetraodon nigroviridis)
Sequence
THFYQIQFASIFICFLLVFTQWWQHSNIACVNEISSTHATSSPAPCGSPDLSKWDKMFSM
LENSQMRENMLLQYADDIIKLETRLRESLERLRLKEQNAAAARNSVGSSNHLEVTLQQLL
SSVQTQANRLAKLEGIHEQQVTSRQADLDGLPDALLQVKVALAEVLRSWQQRNLPAGCEM
ALLFPMRSRRIYAAVASEVPLALSAFTVCMWVKPTVVSGKTVLLSYGDRRNPFEIQLLLG
QTSALLTVGGEAHLVEARGVVKADGTSDWLHLCGTWSSDQGLASLWANGEKAVTTSGVAE
GHVLADGGSLQLGQERNDCCPPTQRKENRVPGFEGGFDPKLAFVGKMTGVNVWSRVLSAA
EISQLALREGRGCGQRGNVVAWGVTEMVPHGGAQFVH
Download sequence
Identical sequences H3DMX1
99883.ENSTNIP00000021869 ENSTNIP00000021869 ENSTNIP00000021869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]