SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000021898 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000021898
Domain Number 1 Region: 312-489
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-50
Family SPRY domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 23-85
Classification Level Classification E-value
Superfamily RING/U-box 2.19e-17
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 101-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000748
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000021898
Sequence length 491
Comment (Tetraodon nigroviridis)
Sequence
PGPAPPGPPQQVVMSSPCCLLTEDQLLCDVCLEVFSEPVSLPCGHTFCRACVEQHWEDSV
QHHCPTCKEIFSAPPQLRTNRFISDVSLLFRGAQRNPQLAKGGDISICPRHQKPLELFCR
TDQSCGCMLCPVQDHKSHDIGLLRDQYENFSESKASVFSHFCAKSLKSRTRLKKEQAEND
LQPSEDRRKELMEEFEQMIHDRRTKMEEIRRSAAVSRKSAERYISESESTFQVLLQTLRR
SQIDLIADLQEKQKDAQRQALPMIRTTVDWAEVSVPPPPYGRKVASTFQDLEERLIKEKE
KLVARSKLLRAQEFFRDVSLDPDTANPFLVLSADGKRVHCGGVCQNLADNPRRFQTACNV
LGWPGCSSGRFYFQVQVEALASWDVGVARESVPRRGPITTSPQNGFWTIGLRDKTQYKAP
GLELRPVEPPKKVGVLVDYEDGRVAFFNVDSAHLLHQFTQCCFSEQLLPFFSPGRRSHCP
NPPSLVICPIS
Download sequence
Identical sequences H3DN00
99883.ENSTNIP00000021898 ENSTNIP00000021898 ENSTNIP00000021898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]