SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000022012 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  99883.ENSTNIP00000022012
Domain Number - Region: 182-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0154
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000022012
Sequence length 515
Comment (Tetraodon nigroviridis)
Sequence
IKMRRHRVFLLCTVGLCVISFLHYYKALHYVSLLRELSAPYPNIKSFIMVTGFFWREKGA
ATTPLSPSSPDEAPPFPGIRQLDAKDPIEMMGDLHTRLYHLQDDRTAYFVRTKAGALCFR
QGTEAAAPREYSARAAGSVAHGDGEGPPGMAAGQRKPLQVQQQPSLSPKAKSRSRGSGKR
LVKCVCRPGWHGPYCGVPTMVYHSNLPTKERLIPRETPRRVINAININHEFDLLHARLHE
LADAVDLFLICESNFTAYGDRRPLTFLQLLLNGTYDYVRHKILYVFLDHFPEGGRQDGWI
ADDYLRTFLTQNGLSRVVGARPDDVFVINDADEIPAREGLLFLKLFDGWTEPFAIHMRKS
LYGFFWKQFGTLEVVSGCTVGMLQKVYDGDGIKLRRREYYSMPGFRKYENETGHILVQWS
VGSPVHFAGWHCSWCFKPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRDLIRTGGWFDG
SQQEYPPVDPKEHMYAPKYILENFGKYHYLLENPY
Download sequence
Identical sequences H3DNB3
99883.ENSTNIP00000022012 ENSTNIP00000022012 ENSTNIP00000022012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]