SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000022023 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000022023
Domain Number 1 Region: 1-220
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.41e-52
Family IMD domain 0.0000646
Further Details:      
 
Domain Number 2 Region: 265-347
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000119
Family SH3-domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000022023
Sequence length 475
Comment (Tetraodon nigroviridis)
Sequence
MSGATSDQIHRSTLSVYLNLMEHFNPGLQKLVALGNAYVKAFQALAVCSEAYFSAVAKMG
EQALHTFTSHALGDVLIQISETQRRLTLEMDGVFKWFQTEVLQAMEKKVKLDEEYIQGSR
KVYELEVRKQAEALEKQLRRGAYRDSLENSEYMLYLRQSQWEILKEEERRYRYLAEKHCG
LTQSLLFLINKAGASFQHKADGWKQKVNDTRGSRPRTPTYLDPESQLQGSVVSLLQTVAK
DEDMSWARREQQALGAVPSRAPSPLPSRSRSSSVGDCLGLGGGGTMRALVSHPSSNPKLL
PFNRGELVTVLVQEPRNGWLFGRTDSSLRQGWFPAAYVVPIEDFSNAIATSSLRSHSMSN
LLDPTNIDESENQSYGEIPPLATPNRRASVDVRAISPLPQKKLEVKHGHGKNYIDQTAPS
QSLGGSADPASDAQVPTLLPHGPPENPLFPRGTNPFATVKLRPTTTDDRSAPRIL
Download sequence
Identical sequences H3DNC4
99883.ENSTNIP00000022023 ENSTNIP00000022023 ENSTNIP00000022023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]