SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000022028 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000022028
Domain Number 1 Region: 138-400
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.67e-57
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 460-586,629-801
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.7e-39
Family Patatin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000022028
Sequence length 814
Comment (Tetraodon nigroviridis)
Sequence
MQFLGRLLDTVSSNLFANPYRVRDVPLSDYAGGGKIKLREEGRMVLYKNNQCRSWDCLLM
CPEMPMSTLRLFQVASEEDAMNWFPHYALTLQPFYEMLPLKAETTQPIVDCIRSHPDWSS
AHVAIDTGLRECLKHNYVQSQINSRDAAGQTPLHLACERGDPVCVKELLEESQAQTDIKD
RSGQTPMHMAAKHDSPAVIQVMCSRMCSGVNELNNSGETPLHVACRLGRVESVKALLAGG
AKCDIIGGAGYPIHSAMKYSEKCCVEEVLKADSGQLHAEDSAYGGTPLHWAKTAEMCRVL
LEHGCEINYLSKTGESPLHIMTKKGRFEAAMVLLTHGANANLKGQDGNTALHLAMKLDHI
ELIKALIVFGADVEIHNDLGETPGLIAARTSKGPNRKILLDMLCSVGVQRCHPPSLNSSP
PNFKPAAIGFEDIIYMGAAVAAMSRGSSQVDGCKMQKNRMDRLLCLDGGGIKGLVLIQML
IALEKEAGRPTRELFDWVAGTSTGGILALAIIHGKSMEYLRCLYFRMKEQVFKGSRPYES
APLEEFLKKEFGENTKMTDIRYPRVMVTSVLADRHPGELHIFRNYDPPSVHREAPYATTA
TFKPLTIPQGWEDEDVLIVGYTEEPPRKRRKVADEEQLVWRAARSSGAPTYFRPMGRFLD
GGLLANNPTLDAMSEIHQYNKALKAEGREKETKKLGVVVSLGTGKPPQVAVSSVDVFRPS
NPLELAKSFVGAKELGKMLVDCCTDSDGCAVDRATAWCEMIDTVYYRLSPQLSQEVLLDE
VSDAALVDMMWETQMYLYEKRESLQSLAKLLLNN
Download sequence
Identical sequences H3DNC9
99883.ENSTNIP00000022028 ENSTNIP00000022028 ENSTNIP00000002157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]