SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000022149 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000022149
Domain Number 1 Region: 38-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-36
Family Laminin G-like module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000022149
Sequence length 421
Comment (Tetraodon nigroviridis)
Sequence
MQRWSLRWKTKRWIMDSTLTAFITLFLVLQAARVKAAEPVDVLKVLEFQNNPEGVERTSG
FCVQRRASKPDSAYRVSKPFQISAPTTQLFPDLAGGVFPQDFSILTTLRAKPGLQSFLLS
IYNEQGVQQLGVEVGRSPVFLYEDQNGKPAPEDYPLFKAFSLADGKWHRVAISVEKNTVT
IILDCKKKLTKPLPRSDNASIDTNGITVFGTRFLDADVFQGDIQQLLIADNPGAAYNYCE
HIPDCETPHSDSMQAQEPEKEPNNVEGDYNTDIDFGTLDDTQTQSPFTTSGPNEEDAVGE
FVTEATPFASEPTIVPETVDELDTGTDAYDFKEYDLKEYDLGEVDGRLYDYGAYDEYGTA
TPKLTATEDEVGPGVAAETDISENTIAGIGEAFGQKGEKGEPAVIEPGMLIEGPPGPPGP
S
Download sequence
Identical sequences H3DNQ0
ENSTNIP00000022149 ENSTNIP00000022149 99883.ENSTNIP00000022149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]