SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000022365 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000022365
Domain Number 1 Region: 4-364
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.7e-124
Family Motor proteins 0.00000000435
Further Details:      
 
Domain Number 2 Region: 1663-1752
Classification Level Classification E-value
Superfamily Cap-Gly domain 4.32e-30
Family Cap-Gly domain 0.0000207
Further Details:      
 
Domain Number 3 Region: 449-542
Classification Level Classification E-value
Superfamily SMAD/FHA domain 8.7e-24
Family FHA domain 0.00047
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000022365
Domain Number - Region: 895-965
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0036
Family PLC-like (P variant) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000022365
Sequence length 1802
Comment (Tetraodon nigroviridis)
Sequence
LNVSNVKVAVRVRPMNRREKDMKTKSVVEMEENQTILHPTTASMSKGDPRSQPKVFAYDH
CFWSMDESQTDKFAAGQDVVFQCLGESLLDNAFMGYNACIFAYGQTGSGKSYTMMGSEEQ
PGLIPRLCSSLFSRILQEAQEGESFTVEVSYMEIYNEKVRDLLDPKGSRHALRVREHNVF
GPYVDGLSHLAVASYKDIESLMSEGNKSRTVAATNMNEESSRSHAVFNVILTHTLMDLQS
GTRGEKVSKLSLVDLAGSERAAKTGAAGERLKEGSNINKSLSTLGLVISALADQGAGKNK
NKFVPYRDSVLTWLLKDSLGGNSRTAMVATISPAADNYDETLSTLRYADRAKSIVNHAVV
NEDPNARIIRELREEVEKLREQLTEAESMKAPELKEQLEESEKLIKEMTVSWEEKLRKTE
AVAQERQKQLESLGISLQSSGIRVVHDKCFLVNLNADPALNELLVYYLKKHTCVGSANSQ
DIQLCGMAIQAQHCIIDVTESNGVVLTPLHNARTHVNGTAVTSPVQLHHGDRILWGNNHF
FRISLPKHKGRAGGEDEEGRAAPKTGSSADRLEVDLEFDASSELNFGYEFAQAEVMMKGM
GSNGISSTQDPLQSVLKTLERQYREEKHCALERQREMYEQELQQLRQQLRPEKASLLQEP
PGLLSSTATAAAASPGSHRRVRRWSEDREAMMTRSLRRLKEQIVKANLLAQEAGFFAEEL
NKKTEYLVTLQIPAANLDANRKRDVVLSEPAIQVRRKGKGKQIWALEKMENRLVDMRELY
QEWKDFDEDNPVMRSYFKRADPFFDEQENHSLIGVANVFLACLFYDVKLQYAVPIINQKG
EVAGRLQVEVWHGTEISEADGAERADVLQTSTAGDPQERRLDCVVKILQATGLPRHLSNF
VFCQYHFWGQEEPVYIAPEIDPQCTVVFDSAQEFSVPVSEELVEFLSEGAVAIEVYGHKQ
ANPRRNLALWDLGVIQAKTRSLRERRWSEVTRRLELWVQLRELNEAGEFTAVEVLPAKDV
RTGGVFQLRQGQSRRVQVEVRSVPDSGTLPLIAASILSVSIGDVKVRQARPPKDFIHLTF
QTGEEEMDSYQEVDLERMKAHWLDSLTQRQEYLDQQLQKIVSKADKSEDDVERESQLLEC
RLTLTEERNAVLVPSAGSGIPGAPVEIWVPVPGMETHVPVLFLDLSADDFQSSSSSPLAG
GVDSLLSEEEEEEFFDLHIVKHEDSEVKAEASWDSTVHECPQLSRVTAGDQRVYLTVKAA
LRLSHPAHMQLVLRKRICVSVTGRQGFAQSLLKRMSPRSGVHGCGVTFEIVSNIPGDIHG
PEDREVLARLAASTDDHQSADSEAAIEKYLRSVLAVENLLTMDRLRQEVAVREHLAATGK
APRRCLSSPNVSRLSTSSLELLPTHKLNDLKGWESHHNLSVAGPPSRRTLPSSASQNLRL
SPDPPPSPTASSLPTVRAVPRLLKSWLRTPVLDSRPRPASLLRKVAPRIVVQSASIEDGI
SKQQQPEVLPDIQPESPRVPLPPPIIPETEDSTPSPVSETSSGYISTSISTATLSDVYTL
RLPTPAPPVGGRAHPDVAEATPELPTSVIPNDSSPPVSGPAQSGVPPSKANPTGTNPFKI
QKVKSSDLKSFQPILGADEAAAPPADRANSLAAPLESLEIISDSEGDAAATLPDWLKEGE
FVTVGGNKSGTVRYVGPADFAEGTWVGVELEVPAGKNDGSVGGRHYFHCNPGYGVLVRPG
RVSRGGTKRRRLQQQQQKRRSANLSDSSPNLAALTALAKGEGGAGGAATSRSRGENRKSW
NT
Download sequence
Identical sequences H3DPB6
ENSTNIP00000004462 99883.ENSTNIP00000022365 ENSTNIP00000022365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]