SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000022397 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000022397
Domain Number 1 Region: 30-520
Classification Level Classification E-value
Superfamily Sema domain 5.23e-183
Family Sema domain 0.0000000000000678
Further Details:      
 
Domain Number 2 Region: 516-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000279
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 585-670
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000898
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000022397
Sequence length 784
Comment (Tetraodon nigroviridis)
Sequence
MGSFWGSAMLLFAAVLLRTEGKGAQESKNNVPRLKLSYKEMLESNNLVTFEGLANSSSYH
TFLLDEEKGRLVVGAKDHIFSFNLLNIRDYAQIPWLASPTRRDECKWAGKDLLRECSNFI
KVLHPFNQTHIYACGTGAFHPVCSYLEVGKKIEDNVFRLMPHIENGRGKSPYDPKLHTAS
MLIDGELYAGTSADFMGRDFAIFRTLGTHHPIRTEQHDSRWLNDPRFVAVHLIPESDNPE
DDKIYLFFKENAIDGEHAGKATYARVGQLCKNDLGGHRSLVNKWTTFLKARLICSVPGSN
GDTHFDELQDVFLVSTKDPKSPMIFAVFTTSSNIFKGSAVCMYNMADIRRVFLGPYAHRD
GPNYQWVPFQGRVPYPRPGTCPSKTFGGYDTTKEFPDEVVTFARSHPAMFNPVYAINNQP
IIVKTDVDYQFTQIVVDKVEAEDGQYDVMFIGTDMGTILKVVCIPRGSWHDLEEVLLEEM
TVFREPTAIRAMELSTKQQQLYLGSDTGVSQMPLHRCEVYGKACAECCLARDPYCAWDGT
ECSRYFPMAKRRTRRQDIRNGDPLTQCSDLQHHDELNGETTLLDKTVYGVENSSTFLECS
PKSQRAVIYWQYQQSADDHKREINSEERFILTNQGLLIRTLSKKDSGIYLCLAVEHGFMQ
TLLKTLEVIDTEHLQNLLHRDEEPAHAPSQERSSPQEGPTQKLWYRDFLSLVNHPTLNSV
DEFCEQVWKRERKHKRQKAQLEVMVDAHNHMHPQGLTAKWKHLQERQKGRNRRTHELERA
PRSV
Download sequence
Identical sequences H3DPE8
ENSTNIP00000022397 ENSTNIP00000022397 99883.ENSTNIP00000022397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]