SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000022682 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000022682
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-58
Family Calnexin/calreticulin 0.000000354
Further Details:      
 
Domain Number 2 Region: 151-186
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 0.00000000196
Family P-domain of calnexin/calreticulin 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000022682
Sequence length 186
Comment (Tetraodon nigroviridis)
Sequence
GLVLKSRAKHHAISTLLLRPFTFNTKPLIVQYEVSFQAGIDCGGAYVKLLSQTPDLDLDQ
FVDKTPYTIMFGPDKCGEEYKLHFIFRHKNPKTGEFEEKHAKKPDADLRSYYTDKKTHLY
TLVLNPDNTFEVLVDQTVVNSGSLLSDMTPPVNPPAEIEDPEDQKPEDWDERPKIQDPAA
TKPEDW
Download sequence
Identical sequences H3DQ83
ENSTNIP00000022682 ENSTNIP00000022682 99883.ENSTNIP00000022682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]