SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000022726 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000022726
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 2.35e-49
Family ATP-dependent DNA ligase DNA-binding domain 0.00000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000022726
Sequence length 133
Comment (Tetraodon nigroviridis)
Sequence
RVPYLAVARTFQKIEEDSGRLRNIETLSNLFRSVLLLSPDDLLCCVYLCLNQLGPAYQGA
ELGVGETVLMKAVAQATGRQLDKIKAEAQERGDLGLVAESSRSNQRTMFQPASLTAAGVF
RKFKEIASMSGNA
Download sequence
Identical sequences Q4TIX0
ENSTNIP00000022726 ENSTNIP00000022726 99883.ENSTNIP00000022726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]