SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000022934 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000022934
Domain Number 1 Region: 105-174
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000141
Family Cadherin 0.0019
Further Details:      
 
Domain Number 2 Region: 21-109
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000557
Family Cadherin 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000022934
Sequence length 175
Comment (Tetraodon nigroviridis)
Sequence
AQADYAPYFYDNGPYSRNGNLALFSLSEDTAVGTLIYRLNGTDPEGQEVRYGLSFDSGSK
EYFRVEPISGNVTLVEKLDREKQDSIDVLVSITDGKSKVVERVTVFVMDANDEKPEFQNM
PAITDVVETTESGSSIYKVQAVDKDTGSGGSVTYYLQRTPQSNLFTIDRHSGVVR
Download sequence
Identical sequences H3DQY5
99883.ENSTNIP00000022934 ENSTNIP00000022934 ENSTNIP00000022934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]