SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15920388|ref|NP_376057.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920388|ref|NP_376057.1|
Domain Number 1 Region: 5-181,243-357
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.58e-49
Family tRNA pseudouridine synthase TruD 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15920388|ref|NP_376057.1|
Sequence length 363
Comment hypothetical protein ST0207 [Sulfolobus tokodaii str. 7]
Sequence
MLGMEKYFINEDWSPLKVFINRPDGFRVIEEISYKPATEWKGSIQGKYAVYLLRKRGIDH
FTVISEISKILHSKIHYIGIKDTNAITEQIVYTTNVKNIIEKYENDKFLLTFLGYSNSKF
NHTGNIFEIEIETDDIKEFEKRVNKLRSIKYLPAYIGYQRFGTKRPITHIIGKMLVLREW
QNAIDFLVGYPFESESELVKKARYAYMKGDLKEALELFPKRFRDERIAIKLLLRNENYFN
ILRNLQTPLIFYIEAYQSYLFNKYLSRIMDPTKIDENLVIKIPTSYDSCDSICREIFREE
GLLNINFKIKELKLNVKDLVRKAYTLIRNLTIKDKKITFALDRGIYATIVIREIARTDPR
LFT
Download sequence
Identical sequences Q976I1
WP_010978148.1.60790 273063.ST0207 gi|15920388|ref|NP_376057.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]