SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15920472|ref|NP_376141.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920472|ref|NP_376141.1|
Domain Number 1 Region: 17-81
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.71e-25
Family Cold shock DNA-binding domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15920472|ref|NP_376141.1|
Sequence length 83
Comment 30S ribosomal protein S28e [Sulfolobus tokodaii str. 7]
Sequence
MSEKEKSQAQSSVIEEFGFPAEVIQILDRTGVTGEVTQVRVRVLEGRDKGRILTRNVKGP
VRLGDILILRETEREARKLTTKR
Download sequence
Identical sequences Q975Z8
WP_010978233.1.60790 gi|15920472|ref|NP_376141.1| 273063.STS040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]