SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15920528|ref|NP_376197.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920528|ref|NP_376197.1|
Domain Number 1 Region: 92-165
Classification Level Classification E-value
Superfamily PUA domain-like 3.73e-19
Family PUA domain 0.0011
Further Details:      
 
Domain Number 2 Region: 9-88
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.000000000000333
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15920528|ref|NP_376197.1|
Sequence length 176
Comment hypothetical protein ST0329 [Sulfolobus tokodaii str. 7]
Sequence
MFNLTKPLKAQKDEINYLRYIAMYQFSSKVASCLFPEDSTFFIQRSLTTNRIRNILTEDK
RLFLVLRAQDNLFSITEISGQIIKNCTSPPSFRFIIKNEVASFIREGRNAFCKFVINSDP
SIRAGDEVLVVDEQDNLLAVGRAKVSGEEVKQYKRGLAVIVKRGIKNVYQDNSKGN
Download sequence
Identical sequences Q975U3
273063.ST0329 gi|15920528|ref|NP_376197.1| WP_010978289.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]