SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15920606|ref|NP_376275.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920606|ref|NP_376275.1|
Domain Number 1 Region: 10-84
Classification Level Classification E-value
Superfamily Pseudouridine synthase 3.17e-18
Family Pseudouridine synthase II TruB 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15920606|ref|NP_376275.1|
Sequence length 84
Comment centromere/microtubule-binding protein [Sulfolobus tokodaii str. 7]
Sequence
MEIYDFIYKIDSFCNYSNNWNIIQDSYTNEKYGYFADKRPIEVLIKNSIINADKPPGPTS
HEVAYWIKQMFKVSKAGHGGTLEP
Download sequence
Identical sequences 273063.STS055 WP_010978367.1.60790 gi|15920606|ref|NP_376275.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]