SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15920648|ref|NP_376317.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920648|ref|NP_376317.1|
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.89e-68
Family G proteins 0.00000435
Further Details:      
 
Domain Number 2 Region: 457-617
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.57e-51
Family Translational machinery components 0.0000357
Further Details:      
 
Domain Number 3 Region: 248-365
Classification Level Classification E-value
Superfamily Translation proteins 1.34e-28
Family Elongation factors 0.001
Further Details:      
 
Domain Number 4 Region: 618-708
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.82e-22
Family EF-G/eEF-2 domains III and V 0.0038
Further Details:      
 
Domain Number 5 Region: 381-457
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.4e-22
Family EF-G/eEF-2 domains III and V 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15920648|ref|NP_376317.1|
Sequence length 724
Comment elongation factor EF-2 [Sulfolobus tokodaii str. 7]
Sequence
MKDITRVRNIGIIAHVDHGKTTTSDTLLAAAGIISQKVAGEALALDYLSVEQQRGITVKA
ANISLYHEIEGKGYVINLIDTPGHVDFSGRVTRSLRILDGSIVVVDAVEGIMTQTETVLR
QSLEERVRPILFINKVDRLVKELKLSPQEIQKKLIDMIVEINNLIEMYAEPEYKDAWKIK
PELGNVVFGSAKDKWGFSVPIAQKKGVKFSDVVNAYSSGDKSKVEELANRVPIHEALLET
VIKFVPNPRDAQKYRIPKIWKGDLDSDIAKAMINADPNGPIVLMISDMKVDPHAGLVATG
RVFSGTLRAGEEIWLVNAKRQQRVLQVSLYMGPTRELAEEIPAGNIAAALGLDQARSGET
AVDIKYKDANVGSFESLHYVSEPVVTISVEPKNPKDLNKMIDALRKLSIEDPNLLVKINE
ETGEYLLSGMGFLHLEVSLQLLKENYGVDVVTSPPIVVYRESIRTKSQVFEGKSPNKHNK
LYISVEPLNEQTIELIANGTIKEDMDSKEMARILKEQADWDYDEAKKIVAIDENINVFVN
ATSGVQHLREVMDTILQGFRLAMKEGPLAHEPIRGLKVVLHDAIIHEDPAHRGPAQLYPA
VRNAIFAGFLTSKPTLLEPLQKLDIRVPMDFVGNVSGVITRKRGKILNMTQMGSIARITA
EIPVSESFELASELRAASAGRAFWGTEFSRWAPVPDSLLLDVIMKIRERKGLPKELPKVE
DFLA
Download sequence
Identical sequences gi|15920648|ref|NP_376317.1| 273063.ST0437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]