SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15920654|ref|NP_376323.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920654|ref|NP_376323.1|
Domain Number 1 Region: 10-176,205-219
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-57
Family Ribonuclease PH domain 1-like 0.000000238
Further Details:      
 
Domain Number 2 Region: 192-273
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.85e-18
Family Ribonuclease PH domain 2-like 0.0000544
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15920654|ref|NP_376323.1|
Sequence length 275
Comment exosome complex RNA-binding protein Rrp42 [Sulfolobus tokodaii str. 7]
Sequence
MSITPSNQNITSLLKKESILNALERGIRLDGRKNSDYRPISVTLNYAKKAEGSALVKLGD
TMVLAGVKLEEEEPFPDTPNQGNLVVNVELLPLAYETFEPGPPDENAIELARVVDRSLRD
SKAVDLSKLVIIPGKKVWTAWVDVYVLDYGGNVLDACTLAAVAALYNTKLPKVEIEGDNV
KIIKEEKTDVTPIAYPVVTVTVAKIGKYLVVDPSLDEESIADVKISFSYVQDGRIVGMQK
SNFGSLSLQEVDVAESLARSASQKLFEELKKQINM
Download sequence
Identical sequences Q975G9
273063.ST0442 WP_010978415.1.60790 gi|15920654|ref|NP_376323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]