SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15920655|ref|NP_376324.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920655|ref|NP_376324.1|
Domain Number 1 Region: 11-184
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.43e-48
Family Ribonuclease PH domain 1-like 0.000000292
Further Details:      
 
Domain Number 2 Region: 157-244
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.64e-25
Family Ribonuclease PH domain 2-like 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15920655|ref|NP_376324.1|
Sequence length 247
Comment exosome complex exonuclease Rrp41 [Sulfolobus tokodaii str. 7]
Sequence
MRQKMIQLQKPRLILDNGLRLDGRKPDEMRPIKIELGVLKNADGSAIFEMGNTKVIAAVY
GPKEMHPRHLALPDRAVLRVRYHMTPFSTDERKNPAPSRREIELSKVIREALESTILVEL
FPRTVIDVFMEVLQADAGTRLVSLMAASMALADAGIPMRDLIAGVAVGKADGVLVLDLNE
PEDMWGEADMPVAMMPSLKQVALLQLNGNMTPQEFRQALEMAQKGIETIYNLEKEAIRSK
YAELKEE
Download sequence
Identical sequences gi|15920655|ref|NP_376324.1| 273063.ST0443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]