SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15920722|ref|NP_376391.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920722|ref|NP_376391.1|
Domain Number 1 Region: 1-153
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.59e-29
Family GHMP Kinase, N-terminal domain 0.000028
Further Details:      
 
Domain Number 2 Region: 163-283
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.73e-23
Family Homoserine kinase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15920722|ref|NP_376391.1|
Sequence length 306
Comment homoserine kinase [Sulfolobus tokodaii str. 7]
Sequence
MIVKAFSSSANLGAGYDILALAHDAFEDTIEIYAQNSSELDIKVEGNGVPLSIDKNSASF
ALLELLRSYDIKAKIRLKIIKGIPAGLGLGSSGASAAAAVYAANEIFKLNLSRQELVNFA
MKGEIASSGSPHPDNVAASLVGGLVSVLNSNPVKVEQVPLNLEFQIILIIPFVRIEAKTK
KAREMVPKQIDTSKYVTNARYLSSLLLGFIKGDRELVRLGLNDEIIEKAREPLFPHYPKI
KEISLLYDAIGACVSGAGPTIAIFVDSKSDKNKILGESLNVCKAYGYECTYKIAKVSGGA
WVERRD
Download sequence
Identical sequences Q975A7
WP_010978483.1.60790 273063.ST0505 gi|15920722|ref|NP_376391.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]