SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15920824|ref|NP_376493.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920824|ref|NP_376493.1|
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily PUA domain-like 1.82e-31
Family Atu2648/PH1033-like 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15920824|ref|NP_376493.1|
Sequence length 147
Comment hypothetical protein ST0604 [Sulfolobus tokodaii str. 7]
Sequence
MYWLIPVQEDFWETVVKTNLFGFHKESVEKYIKPGDFIIFYVGKYYAKKYGGKFVGIFKV
ISDWFYDETVVFPNEKLVGKAIEVYRIKLEPIIIGECPSKDIIWNLSFIEDKFQFSKYLR
NVPANLKRPIPEEDAKKIEECLKASII
Download sequence
Identical sequences Q974Q5
WP_010978585.1.60790 gi|15920824|ref|NP_376493.1| 273063.ST0604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]