SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15921062|ref|NP_376731.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921062|ref|NP_376731.1|
Domain Number 1 Region: 39-199
Classification Level Classification E-value
Superfamily vWA-like 1.43e-21
Family Integrin A (or I) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921062|ref|NP_376731.1|
Sequence length 360
Comment hypothetical protein ST0828 [Sulfolobus tokodaii str. 7]
Sequence
MTISLKIKSSHSYVSIEKPTQISLIIRVVPETFVQFTGIHYVILIDNSPSMRKDNKLDVA
IAAANKLSYEIPPGNYISIYLFSNDLEKIYEGPSGNPIALQNVKKGYTTNLHKALSKILQ
QLAYVQLPVKLIILSDGKPTDKRNVKEYEGLQVPPNVQIISIGIGRDYNEVILKRMADKG
SGVYYHIEDPTQLPSVFAQQKVSEVAGYNFVLNVPPGFEVINYEVPVNIPIIDRTISIYA
IGTIPPGTQPVQLLFTGSYYDPAKRINVPINEQLIIPRGNEVQVIQGVNQGILSEVRYYS
LLKQYSNAIASGSKDATVIAQELRVAAEQTRREDLIEETRRLTGDSKTDLSEVTRTMRKS
Download sequence
Identical sequences Q973S0
WP_010978823.1.60790 273063.ST0828 gi|15921062|ref|NP_376731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]