SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15921064|ref|NP_376733.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921064|ref|NP_376733.1|
Domain Number 1 Region: 41-195
Classification Level Classification E-value
Superfamily vWA-like 1.11e-29
Family Integrin A (or I) domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15921064|ref|NP_376733.1|
Sequence length 381
Comment hypothetical protein ST0830 [Sulfolobus tokodaii str. 7]
Sequence
MIFLTISARLEFSHKYSFTSPVRGVFRLILVPERVSVATGFHYIILLDTSGSMAGIKIET
AKQGALQLLNKIPPGNKITFITFSSTVNTLIEFADTSGSVGETISSVTAQGNTVLYTALS
TAIQIAKKHGIPGYIILLTDGNPTDLTNTDAYEKLQFPDGFKVISFGIGDDYNEQLLKVL
ADKTGGILNHIQDPMEIANSLPQAAVTQVGAKNVIVEINSPSQVKLLNYSGPPVKLGAIE
GVVRIFGETSIPPNFNGNILDVKITYEDPATNRTENIIAVSQVTPASSSQVFLSGINNDI
LNEYQYYELMNKLVTQVNSNNLAEATRTLQQMNQLAEQTRRIELMETTRRLQQSIETTRR
LGNVEQTKKIITSEATKKLRS
Download sequence
Identical sequences 273063.ST0830 gi|15921064|ref|NP_376733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]