SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15921116|ref|NP_376785.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921116|ref|NP_376785.1|
Domain Number 1 Region: 7-81
Classification Level Classification E-value
Superfamily SirA-like 3.66e-19
Family SirA-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921116|ref|NP_376785.1|
Sequence length 83
Comment hypothetical protein STS099 [Sulfolobus tokodaii str. 7]
Sequence
MSEDLKLRNPDQVLDVRGESCPVPEMEASKKLKKMKVGQLLEVLTDHQPAVDVTLPSLAK
NLGYPYVIIKDGEVYRVRILKVK
Download sequence
Identical sequences Q973L8
gi|15921116|ref|NP_376785.1| WP_010978877.1.60790 273063.STS099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]