SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15921182|ref|NP_376851.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921182|ref|NP_376851.1|
Domain Number 1 Region: 66-278
Classification Level Classification E-value
Superfamily PRTase-like 1.07e-38
Family Phosphoribosylpyrophosphate synthetase-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15921182|ref|NP_376851.1|
Sequence length 291
Comment ribose-phosphate pyrophosphokinase [Sulfolobus tokodaii str. 7]
Sequence
MIIIGGTATNGIDENLSKIISVPLLKVEHKVFPDGESYIRIPQHITNQEILVVQSLYPPQ
DKHFVELLLILETLADMKNNKITAIVPYLAYSRQDRRFKEGEALSIKTILNAIARAGADV
LIVIEPHKEEELSYFGKEVKIADPMPELAKEVSKKVEKPFVLAPDRGALERAKRLAEQLN
AEYSYIEKERDRDTGEVRIKNLPELRLSGKDVIIVDDIISTGGTMIQATRAAYEHGARKV
ISVAVHSLFLDNAYEKLINSGVKEIVTTNTIPQDPSKVTVVDVSPAIARKI
Download sequence
Identical sequences Q973F3
273063.ST0946 gi|15921182|ref|NP_376851.1| WP_010978942.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]