SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15921219|ref|NP_376888.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921219|ref|NP_376888.1|
Domain Number 1 Region: 109-253
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.01e-42
Family Mevalonate 5-diphosphate decarboxylase 0.00049
Further Details:      
 
Domain Number 2 Region: 4-103
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.53e-26
Family GHMP Kinase, N-terminal domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15921219|ref|NP_376888.1|
Sequence length 257
Comment diphosphomevalonate decarboxylase [Sulfolobus tokodaii str. 7]
Sequence
MKEYSGRVLNIFRKLYGKEIYAKVESWSNFPKSTGLASSAAGIAALVYATNEALELGLSQ
KELSKIARIGSGSACRSTAGGFVLWEKGERDDGEDSYCYSLFPENHWKELVDIIAIVSEK
SKKISSREGMIITAKTSNLMKCRLKFIEETLPKVIKSIEERNEKEFYYWLMRHSNSMHAV
ILDSWPSFFYLNDTSLKIMEWIQEFGKAGYTFDAGPNPHIFTTEKYKDEVIRFLNSIGVN
KIIISKVGSGPKVNKLL
Download sequence
Identical sequences 273063.ST0977 gi|15921219|ref|NP_376888.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]