SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15921385|ref|NP_377054.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15921385|ref|NP_377054.1|
Domain Number - Region: 110-228
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000645
Family ATP-dependent protease Lon (La), catalytic domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921385|ref|NP_377054.1|
Sequence length 527
Comment hypothetical protein ST1128 [Sulfolobus tokodaii str. 7]
Sequence
MIKMNKNILIAILTILIIVAGISGYLVGKTENGNATSTTTTVTKTIEQVVPSPVSDPANL
GNGEDYLINPVFPDHTIASQYAYVTPGEGLVFIGNPYLSGNGYLAGAKGAAVIASMLAYQ
PLTEYNYYLYINSPYCINVPGAVKTDSATVMYLASMLNQQSELNKSLYFLGDVGLEGYMY
STGVVYQRIVQLYQGGIYYLVVPQMMALAEGQNYQMALQFAKEHHEVLYTVSSIPQIYQI
TTGSKLPTPSGYIDFPINFSIGYLYLEHLYQQLYNSSTNVTAKQLAQKYWSEAQKLANEG
NYTAFYFLPNPAVEAIQILYQPYYNLSLEVQEAINNASTLSNLWKIETASEAAYLSHGNI
TEQILANAWAALSLSINVGPTITPYGFYQGLYNAFLTDLYAAEYLDAVTNSHYGNITLLI
QIYRNPNVIYDFGFFTNYYAMMAIQFRDYFLKQLNSTDQAVVLNSIYSYMANETQILENA
AAYFDGPSIVGYMMMNYGLQTHNLDLLYYSMPYIRFVMNTEELTWYI
Download sequence
Identical sequences Q972K3
273063.ST1128 gi|15921385|ref|NP_377054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]